Semaglutide

1-AG S is a medication originally developed to help regulate blood sugar in people with type 2 diabetes. It mimics a natural hormone in the body (GLP-1) that helps control appetite, insulin levels, and digestion. Recently, it has gained significant attention in research for its effects on weight loss and metabolic health.
This product is a prescription medication approved for the treatment of type 2 diabetes and weight management. This content is provided for educational purposes only and does not constitute medical advice.

What is Semaglutide?

1-AG is a GLP-1 receptor agonist originally developed to treat type 2 diabetes. It works by mimicking the body's natural GLP-1 hormone to regulate blood sugar, curb appetite, and slow digestion. In recent clinical trials, it has also shown powerful effects on long-term weight loss, leading to its FDA approval under the brand name Wegovy for chronic weight management.


Potential Benefits Shown in Studies

  • Supporting long-term weight loss
  • Reducing appetite and food cravings
  • Controlling blood sugar levels
  • Slowing digestion to help with fullness
  • Supporting cardiovascular health
  • Improving insulin sensitivity
  • Lowering inflammation in metabolic tissues

Mechanisms of Action

1-AG exerts its effects by:

  • Activating GLP-1 receptors in the pancreas and brain
  • Stimulating insulin secretion in response to elevated blood glucose
  • Suppressing glucagon release, lowering hepatic glucose output
  • Slowing gastric emptying, which promotes a feeling of fullness
  • Reducing appetite through action on brain regions that regulate hunger

Research Highlights

Weight Loss Outcomes

In the STEP 1 trial, patients with obesity receiving Semaglutide 2.4 mg weekly lost an average of 14.9% of their body weight in 68 weeks — significantly outperforming the placebo group.

Source: Wilding, J. P. H. et al. (2021). Once-Weekly Semaglutide in Adults with Overweight or Obesity – NEJM.

Diabetes and Metabolic Health

Semaglutide improves HbA1c levels, increases insulin sensitivity, and reduces the risk of cardiovascular events in people with type 2 diabetes.

Source: Davies, M. et al. (2021). Semaglutide and Cardiometabolic Risk – The Lancet.

Molecular Structure

Sequence

HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG — with a modification at position 26 (Lys26 acylated with a C-18 fatty diacid chain for longer activity)

Molecular Formula

C₁₈₇H₂₉₁N₄₅O₅₉

Molecular Weight

4113.58 g/mol

Source
PubChem

Sources